NCT06812767

Brief Summary

Objectives: to study the clinical and demographic characteristics of working age persons, to highlight the main factors of non-communicable diseases (NCDs), to identify NCDs with physical examination, laboratory tests, electrocardiography and ultrasound imaging, to develop a corporate prevention program for the company to reduce the risk of complications of NCDs. Research stages:

  1. 1.Questionnaire to identify socio-demographic, behavioral, hereditary, psycho-emotional risk factors of NCDs
  2. 2.Laboratory tests (analysis of glucose and cholesterol in the capillary blood, detection of microalbuminuria), diagnostic tests (electrocardiography, and carotid artery ultrasound)
  3. 3.Evaluation of the results of questionnaires and surveys. Recommendations for lifestyle modification and follow-up in a local healthcare department

Trial Health

55
Monitor

Trial Health Score

Automated assessment based on enrollment pace, timeline, and geographic reach

Trial has exceeded expected completion date
Enrollment
2,000

participants targeted

Target at P75+ for all trials

Timeline
Completed

Started Apr 2025

Shorter than P25 for all trials

Geographic Reach
1 country

1 active site

Status
enrolling by invitation

Health score is calculated from publicly available data and should be used for screening purposes only.

Trial Relationships

Click on a node to explore related trials.

Study Timeline

Key milestones and dates

First Submitted

Initial submission to the registry

February 1, 2025

Completed
5 days until next milestone

First Posted

Study publicly available on registry

February 6, 2025

Completed
2 months until next milestone

Study Start

First participant enrolled

April 1, 2025

Completed
1 year until next milestone

Primary Completion

Last participant's last visit for primary outcome

April 1, 2026

Completed
Same day until next milestone

Study Completion

Last participant's last visit for all outcomes

April 1, 2026

Completed
Last Updated

February 6, 2025

Status Verified

February 1, 2025

Enrollment Period

1 year

First QC Date

February 1, 2025

Last Update Submit

February 1, 2025

Conditions

Keywords

arterial hypertensioncoronary heart diseasecerebrovascular diseasemalignant tumorschronic obstructive pulmonary diseaseasthmadiabetes mellitusenvironmentsmokingalcohol consumptionunbalanced diethypodynamiaobesityoverweightdyslipidemiahyperglycemiamicroalbuminuria

Outcome Measures

Primary Outcomes (2)

  • prevalence of NCDs risk factors

    risk factors of NCDs based on survey results and diagnostic tests

    on enrollment

  • prevalence of NCDs

    diagnosed NCDs based on survey results, and diagnostic tests

    on enrollment

Secondary Outcomes (1)

  • Hospitalization

    on enrollment

Study Arms (1)

Persons without NCDs

Persons without known NCDs and not using any medication on a permanent basis

Diagnostic Test: electrocardiographyDiagnostic Test: analysis for glucose and cholesterol in the capillary bloodDiagnostic Test: detection of microalbumuriaDiagnostic Test: heart ultrasound examinationDiagnostic Test: carotid artery ultrasound examination

Interventions

electrocardiographyDIAGNOSTIC_TEST

12 standard leads

Persons without NCDs

express test

Persons without NCDs

express test

Persons without NCDs

Ultrasound examination with Lumify Handheld S4-1 Phased Array Ultrasound (Philips)

Persons without NCDs

Ultrasound examination with Lumify Handheld L12-4 Linear Array Ultrasound (Philips)

Persons without NCDs

Eligibility Criteria

Age18 Years+
Sexall
Healthy VolunteersYes
Age GroupsAdult (18-64), Older Adult (65+)
Sampling MethodProbability Sample
Study Population

The study is planned to include all working citizens who meet the inclusion criteria and have come for preventive examination. In total, at least 2,000 people are planned to be included in the study. All participants will be given informed consent to participate in the clinical trial

You may qualify if:

  • employees of the company
  • persons without NCDs diagnosis and not receiving permanent medication
  • residents of the region of the Russian Federation where a factory with permanent or temporary registration is located

You may not qualify if:

  • refusal to sign informed consent
  • any NCDs requiring constant medication
  • active cancer
  • pulmonary embolism
  • valve defects of the heart (except secondary mitral regurgitation)

Contact the study team to confirm eligibility.

Sponsors & Collaborators

Study Sites (1)

National Medical Research Center for Therapy and Preventive Medicine

Moscow, Russia

Location

Biospecimen

Retention: NONE RETAINED

blood and urine samples

MeSH Terms

Conditions

Noncommunicable DiseasesHypertensionCoronary DiseaseCerebrovascular DisordersNeoplasmsPulmonary Disease, Chronic ObstructiveAsthmaDiabetes MellitusSmokingAlcohol DrinkingHypokinesiaObesityOverweightDyslipidemiasHyperglycemia

Interventions

Electrocardiography

Condition Hierarchy (Ancestors)

Disease AttributesPathologic ProcessesPathological Conditions, Signs and SymptomsVascular DiseasesCardiovascular DiseasesMyocardial IschemiaHeart DiseasesBrain DiseasesCentral Nervous System DiseasesNervous System DiseasesLung Diseases, ObstructiveLung DiseasesRespiratory Tract DiseasesChronic DiseaseBronchial DiseasesRespiratory HypersensitivityHypersensitivity, ImmediateHypersensitivityImmune System DiseasesGlucose Metabolism DisordersMetabolic DiseasesNutritional and Metabolic DiseasesEndocrine System DiseasesBehaviorDrinking BehaviorDyskinesiasNeurologic ManifestationsSigns and SymptomsOvernutritionNutrition DisordersBody WeightLipid Metabolism Disorders

Intervention Hierarchy (Ancestors)

Heart Function TestsDiagnostic Techniques, CardiovascularDiagnostic Techniques and ProceduresDiagnosisElectrodiagnosis

Study Officials

  • Olga Dzhioeva, MD, PhD

    National Medical Research Center for Therapy and Preventive Medicine

    STUDY DIRECTOR

Study Design

Study Type
observational
Observational Model
COHORT
Time Perspective
CROSS SECTIONAL
Sponsor Type
OTHER GOV
Responsible Party
SPONSOR

Study Record Dates

First Submitted

February 1, 2025

First Posted

February 6, 2025

Study Start

April 1, 2025

Primary Completion

April 1, 2026

Study Completion

April 1, 2026

Last Updated

February 6, 2025

Record last verified: 2025-02

Locations