NCT02343367

Brief Summary

The H4K Trial is a randomized controlled trial to improve children's body composition by testing a comprehensive, culturally and linguistically relevant, family-oriented intervention for overweight and obese Hispanic children (ages 6-11) in three pediatric clinics in San Antonio, Texas. The H4K trial will test the efficacy of a 6-month pediatric obesity management intervention (physician counseling plus telephone counseling, newsletters and text messages) compared to standard care (physician counseling only) on three outcomes: 1) body composition (i.e., waist circumference, weight and z-BMI); 2) insulin, glucose and cholesterol levels; and 3) behavior change in physical activity (PA), sedentary behavior and consumption of sugary beverages and fruits and vegetables. The investigators will recruit 230 overweight and obese children-and a parent or guardian for each-and randomize them to the H4K intervention (n = 115 child/parent dyads) or standard care (n = 115 child/parent dyads). The investigators hypothesize that intervention children will significantly improve their body composition, increased their PA levels and diet quality (more fruits and vegetables and less sugary beverages), and decrease their sedentary activity, compared to children in standard care. If successful, this study will generate new scientific knowledge about effective Hispanic family-based approaches for obesity prevention with high potential for replication in underserved areas across the nation.

Trial Health

87
On Track

Trial Health Score

Automated assessment based on enrollment pace, timeline, and geographic reach

Enrollment
518

participants targeted

Target at P75+ for not_applicable

Timeline
Completed

Started Jan 2015

Longer than P75 for not_applicable

Geographic Reach
1 country

1 active site

Status
completed

Health score is calculated from publicly available data and should be used for screening purposes only.

Trial Relationships

Click on a node to explore related trials.

Study Timeline

Key milestones and dates

Study Start

First participant enrolled

January 1, 2015

Completed
5 days until next milestone

First Submitted

Initial submission to the registry

January 6, 2015

Completed
16 days until next milestone

First Posted

Study publicly available on registry

January 22, 2015

Completed
4.8 years until next milestone

Primary Completion

Last participant's last visit for primary outcome

November 19, 2019

Completed
4 months until next milestone

Study Completion

Last participant's last visit for all outcomes

March 31, 2020

Completed
Last Updated

December 21, 2020

Status Verified

December 1, 2020

Enrollment Period

4.9 years

First QC Date

January 6, 2015

Last Update Submit

December 17, 2020

Conditions

Keywords

Hispanicoverweightfamiliespediatricprimary care

Outcome Measures

Primary Outcomes (3)

  • Change from baseline in weight (kg)

    Weight will be measured using a portable Tanita Body Composition Analyzer SC-331S following standard protocol.

    6 months

  • Change from baseline in waist circumference (cm)

    Waist circumference (minimum waist girth) will be measured to the nearest 0.1 cm using a Myotape tape measure at the midpoint between the right iliac crests and the lower ribs when the subject is standing erect with feet together

    6 months

  • Change from baseline in body mass index (BMI z score)

    BMI will be calculated as weight (kg)/height squared (m2). Weight will be measured by bioelectrical impedance analysis (BIA) using the foot-to-foot pressure contact electrode BIA technique using a portable Tanita Body Composition Analyzer SC-331S following standard protocol. Height will be measured to the nearest 0.1 inch using a SECA brand stadiometer.

    6 months

Secondary Outcomes (6)

  • Change from baseline in fasting insulin (µIu/mL)

    6 months

  • Change from baseline in fasting glucose (mg/dL)

    6 months

  • Change in cholesterol (lipid panel: fasting total cholesterol, HDL cholesterol, LDL cholesterol and triglycerides) from baseline (mg/dL)

    6 months

  • Change from baseline in moderate-to-vigorous physical activity (minutes/week)

    6 months

  • Change from baseline in consumption of sugar-sweetened beverages (servings/week)

    6 months

  • +1 more secondary outcomes

Study Arms (2)

Standard Care

ACTIVE COMPARATOR

Brief patient-centered behavioral counseling using the Healthy Lifestyle Prescription, health education materials and a community resource guide. Follow-up visits scheduled at 1, 6, and 12 months. Parent receives weekly general health education cell phone text messages for 12 months

Behavioral: behavioral counselingOther: Education MaterialsBehavioral: Text messages

Pediatric Obesity Management

EXPERIMENTAL

All elements of standard care plus a family-based face to face counseling session with a health educator, telephone counseling, mailed newsletters and regularly scheduled cell phone text messages with tips and motivational messages for healthy eating and PA, as well as information on community events and resources.

Behavioral: behavioral counselingOther: Education MaterialsBehavioral: Face to face counseling sessionBehavioral: Text messagesBehavioral: Telephone CounselingBehavioral: Newsletters

Interventions

Pediatrician trained in motivational interviewing techniques provides brief lifestyle behavioral counseling to child and parent using a Healthy Lifestyle Prescription

Pediatric Obesity ManagementStandard Care

Health education materials about healthy eating and physical activity and a community resource guide

Pediatric Obesity ManagementStandard Care

30 minute face-to-face family-centered behavioral counseling session delivered by a health educator

Pediatric Obesity Management
Text messagesBEHAVIORAL

regularly scheduled cell phone text messages for 12 months

Also known as: SMS
Pediatric Obesity ManagementStandard Care

14 telephone counseling sessions delivered by a health educator using motivational interviewing techniques. Two sessions per month for the first two months followed by one session per month for 10 months

Pediatric Obesity Management
NewslettersBEHAVIORAL

12 monthly newsletters mailed to participant homes

Pediatric Obesity Management

Eligibility Criteria

Age6 Years - 11 Years
Sexall
Healthy VolunteersNo
Age GroupsChild (0-17)

You may qualify if:

  • A child is eligible for the POM trial for meeting the following criteria:
  • identified by parent or legal guardian as Hispanic
  • age 6-11
  • overweight or obese (BMI between the 85th and 99.9thth (\<99th) percentile for age and gender
  • one parent/guardian that the child resides with full-time must agree to participate in intervention and evaluation activities.

You may not qualify if:

  • A child will be excluded if he/she has:
  • a mental, emotional, or physical handicap identified by parents or health care provider that may interfere with study participation
  • a diagnosis of cardiovascular, pulmonary, or digestive disease
  • parent without a cell phone
  • parent unable or not willing to receive text messages
  • child or parent planning to move from the local area within the time span of the study.

Contact the study team to confirm eligibility.

Sponsors & Collaborators

Study Sites (1)

University of Texas Health Science Center San Antonio

San Antonio, Texas, 78229, United States

Location

MeSH Terms

Conditions

Pediatric ObesityOverweight

Interventions

Behavior Therapy

Condition Hierarchy (Ancestors)

ObesityOvernutritionNutrition DisordersNutritional and Metabolic DiseasesBody WeightSigns and SymptomsPathological Conditions, Signs and Symptoms

Intervention Hierarchy (Ancestors)

PsychotherapyBehavioral Disciplines and Activities

Study Officials

  • Deborah M Parra-Medina, PhD

    UT Health San Antonio

    PRINCIPAL INVESTIGATOR

Study Design

Study Type
interventional
Phase
not applicable
Allocation
RANDOMIZED
Masking
TRIPLE
Who Masked
CARE PROVIDER, INVESTIGATOR, OUTCOMES ASSESSOR
Purpose
TREATMENT
Intervention Model
PARALLEL
Sponsor Type
OTHER
Responsible Party
SPONSOR

Study Record Dates

First Submitted

January 6, 2015

First Posted

January 22, 2015

Study Start

January 1, 2015

Primary Completion

November 19, 2019

Study Completion

March 31, 2020

Last Updated

December 21, 2020

Record last verified: 2020-12

Locations